PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG008214t1
Common NameTCM_008214
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family HB-other
Protein Properties Length: 1781aa    MW: 199841 Da    PI: 5.1436
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG008214t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox597.8e-192882357
                      --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
          Homeobox  3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                      kR   t++qle+Le+ +++++yps+++r+eL+ +lgL++rq ++WF+ rR k++k
  Thecc1EG008214t1 28 KRKMKTASQLEILEKTYAMEMYPSEATRAELSVQLGLSDRQLQMWFCHRRLKDRK 82
                      89999************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-18982IPR009057Homeodomain-like
SuperFamilySSF466893.51E-161582IPR009057Homeodomain-like
PROSITE profilePS5007116.5032383IPR001356Homeobox domain
SMARTSM003897.3E-172587IPR001356Homeobox domain
CDDcd000863.07E-142682No hitNo description
PfamPF000462.1E-162882IPR001356Homeobox domain
SMARTSM005714.6E-22550609IPR018501DDT domain
PROSITE profilePS5082716.82550609IPR018501DDT domain
PfamPF027912.4E-16551606IPR018501DDT domain
PfamPF050661.5E-15732800IPR007759HB1/Asxl, restriction endonuclease HTH domain
PfamPF156121.1E-7951992IPR028942WHIM1 domain
PfamPF156131.4E-1311331205IPR028941WHIM2 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1781 aa     Download sequence    Send to blast
MDSGGVSGGG GSSEGEKKKP PEGETKVKRK MKTASQLEIL EKTYAMEMYP SEATRAELSV  60
QLGLSDRQLQ MWFCHRRLKD RKAPPVKRRR KDSSLPAQVV GVAGEEMGGG EAENEHGSDV  120
SSLFGPGLHL RRAVPIPGMA VPRYYEMTHS MAELELRAIT FVELQLGEPI RDDGPMLGME  180
FDPLPPGAFG APIGASTAVQ QKQPGQPFET KIYERLDTKA VKGSVRAVHE YQFLPEQPSV  240
RTETYERVAL SYHYGSPTDD PHARASSLST GCSFVHGNEK VPSGYGFSGQ MPNLNLLPQQ  300
SRQGHLLPTA SGEYDNCSRK NSLTNTTVDA IIGAHPISAL ESPFVSSDRR VNLDEDALRM  360
ERKRKSEEAR IAREVEAHEK RIRKELEKQD ILRRKREEQI RKEMERHDRE RRKEEERLLR  420
EKQREEERYQ REQRRELERR EKFLMKESIR AERMRQKEEL RKEKEAARLK AANERAIARK  480
LAKESMELIE DERLELMELA ASSKGLSSTL SLDFEILQNL DIFRDKLCVF PPKGVQLKRS  540
FSIEPWNSSE ESIGNLLMVW RFLITFADVV GLWPFTLDEL VQAFHDYDPR LLGEIHVALL  600
RSIIKDIEDV ARTPSTGLGA SQNNAANPGG GHLQIVEGAY AWGFDIRSWQ GHLNMLTWPE  660
ILRQFALSAG FGPQLKKRNI EQAYLRDENE GNDGEDIITN LRNGAAAENA VAIMQERGFS  720
NPRRSRHRLT PGTVKFAAFH VLSLEDSDGL TILEVAEKIQ KSGLRDLTTS KTPEASIAAA  780
LSRDTKLFER TAPSTYCVRS PYRKDPADAE AILSAARERI RVLKSGFVGE DAEGAERDED  840
SESDIAEDLE VDDLGAEINP KKEMLNSEGS SSCDAKTILG NEKEICEILE TPQGEVRNVC  900
KALSSPTAGG LDEVKYIDAP VEQSMDAAGI CNGAANAGLE DTEIDESKLG EPWVQGLMEG  960
DYSDLSVEER LNALIALISI AIEGNSIRVV LEERLEAANA LKKQMWAEAQ LDKRRMKEEF  1020
VLRTNFSSHM GNKMEPSLMM SSAECRQSPQ IISDRKNNES SVDLVVQQEC LNNPQNDQNY  1080
LNNVPSEGNM PIQDFSIGPD NLQYPQPGCA AERSRSQLKS YIGHKAEEMY VYRSLPLGQD  1140
RRHNRYWRFI TSASWNDPGC GRIFVELLDG RWRLIDTEEG FDTLLSSLDV RGVRESHLHA  1200
MLQKIEMSFK EAVRRNKLHV NMERQNGDTI KKEANEMASG PDWNVSFESP SSTVSGSDSD  1260
MSETSTSFSI ELCRNEIEKN DALKRYRDFE KWMWKECFSL SSFCATKYGR RRCKQLLGVC  1320
DSCFNIYFFE DNHCPSCHRT DIASRSMLNF SEHVAQCAKK LQLGPGFALD GLVISPLRIR  1380
LTKLQLALVE VSIPFEALQS AWTEGYRNFW GMKLYSSTTA EELLQVLTLL ESSITRDYLS  1440
SNFETTRELL SPSILSGGVG DDSTNLETVP VLPWIPKTTA AVALRLIEFD AAISYTLKQR  1500
AETHKGAGEC MFPSKDAVVK NNQDHERMQT TNRVEYLQEA SWVDVGIGFS GSGRGRGRGR  1560
GRGVTRGGRS QRRPTGSRSE FGKRITTTDN EGLVPVLGWK SRSRGRGGRK RGRRSARSRP  1620
KPAKRMVEIA GERENPKEIM EKSSRNLATN TWNGDEVTRL KVRTADNASS SERSEYNDEN  1680
GQATGDEYDY LAGEDYAGGF NGKADDVMEG SEYNIDGDED DDGEERDDIA EGEQGNFIVG  1740
GYINENSDEE EIRNGDDPED SDPYVKQYGY STEASSDFSE *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
115531562RGRGRGRGRG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007043691.10.0Homeodomain-like transcriptional regulator, putative isoform 1
SwissprotQ9FFH10.0RLT2_ARATH; Homeobox-DDT domain protein RLT2
TrEMBLA0A061E4G40.0A0A061E4G4_THECC; Homeodomain-like transcriptional regulator, putative isoform 1
STRINGPOPTR_0017s04760.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G44180.10.0Homeodomain-like transcriptional regulator
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]